[KO Validated] IFITM3 Rabbit polyclonal antibody

Size

POA

SKU:: A13070
Additional Names:: 1-8U|DSPA2b|IP15|M3
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 15 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Uniprot:: Q01628
Synonyms:: 1-8U;dispanin subfamily A member 2b;DSPA2b;interferon-induced transmembrane protein 3;interferon-inducible protein 1-8U;IP15
Extra Details:: Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 and belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.