A13069
BET1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13069
- Additional Names:
- BET1|HBET1
- Application:
- ELISA, WB
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQT
- Uniprot:
- O15155
- Synonyms:
- BET1 homolog;Bet1p homolog;blocked early in transport 1 homolog;Golgi vesicular membrane trafficking protein p18;golgi vesicular membrane-trafficking protein p18;HBET1
- Extra Details:
- This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice