A13058
AP3D1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13058
- Additional Names:
- ADTD|AP3D1|hBLVR|HPS10
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVE
- Uniprot:
- O14617
- Synonyms:
- adapter-related protein complex 3 subunit delta-1;adaptor related protein complex 3 delta 1 subunit;Adaptor-related protein complex 3 subunit delta-1;ADTD;AP-3 complex delta subunit, partial CDS;AP-3 complex subunit delta;AP-3 complex subunit delta-1;delta adaptin;Delta-adaptin;hBLVR;HPS10;subunit of putative vesicle coat adaptor complex AP-3
- Extra Details:
- The protein encoded by this gene is a subunit of the AP3 adaptor-like complex, which is not clathrin-associated, but is associated with the golgi region, as well as more peripheral structures. The AP-3 complex facilitates the budding of vesicles from the golgi membrane, and may be directly involved in trafficking to lysosomes. This subunit is implicated in intracellular biogenesis and trafficking of pigment granules, and possibly platelet dense granules and neurotransmitter vesicles. Defects in this gene are a cause of a new type of Hermansky-Pudlak syndrome.
- Shipping Conditions:
- Blue Ice