A13041
PPP1R7 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13041
- Additional Names:
- PPP1R7|SDS22
- Application:
- ELISA, WB
- Molecular Weight:
- 39kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
- Uniprot:
- Q15435
- Synonyms:
- protein phosphatase 1 regulatory subunit 22;protein phosphatase 1 regulatory subunit 7;protein phosphatase 1, regulatory (inhibitor) subunit 7;SDS22;testis secretory sperm-binding protein Li 210a
- Extra Details:
- This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice