A13030
MTNR1A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13030
- Additional Names:
- MEL-1A-R|MT1|MTNR1A
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 39 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
- Uniprot:
- P48039
- Synonyms:
- MEL-1A-R;mel1a receptor;melatonin receptor type 1A;MT1
- Extra Details:
- This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin.
- Shipping Conditions:
- Blue Ice