A12937
p63 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12937
- Additional Names:
- AIS|B(p51A)|B(p51B)|EEC3|KET|LMS|NBP|OFC8|p40|p51|p53CP|p63|p73H|p73L|RHS|SHFM4|TP53CP|TP53L|TP73L
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 63-75 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALS
- Uniprot:
- Q9H3D4
- Synonyms:
- AIS;amplified in squamous cell carcinoma;B(p51A);B(p51B);chronic ulcerative stomatitis protein;EEC3;keratinocyte transcription factor KET;KET;LMS;NBP;OFC8;p40;p51;p53CP;p63;p73H;p73L;RHS;SHFM4;TP53CP;TP53L;TP73L;transformation-related protein 63;tumor protein 63;tumor protein p53-competing protein;Tumor protein p73-like
- Extra Details:
- This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gene and the use of alternative promoters results in multiple transcript variants encoding different isoforms that vary in their functional properties. These isoforms function during skin development and maintenance, adult stem/progenitor cell regulation, heart development and premature aging. Some isoforms have been found to protect the germline by eliminating oocytes or testicular germ cells that have suffered DNA damage. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8.
- Shipping Conditions:
- Blue Ice





