A12932
Fibronectin Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12932
- Additional Names:
- CIG|ED-B|Fibronectin|FINC|FN|FNZ|GFND|GFND2|LETS|MSF|SMDCF
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 272 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
- Uniprot:
- P02751
- Synonyms:
- CIG;cold-insoluble globulin;ED-B;epididymis secretory sperm binding protein;fibronectin;FINC;FN;FNZ;GFND;GFND2;LETS;migration-stimulating factor;MSF;SMDCF
- Extra Details:
- This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined.
- Shipping Conditions:
- Blue Ice



