TAL1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12927
Additional Names:: bHLHa17|SCL|tal-1|TAL1|TCL5
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Uniprot:: P17542
Synonyms:: bHLHa17;class A basic helix-loop-helix protein 17;SCL;stem cell protein;T-cell acute lymphocytic leukemia 1;T-cell acute lymphocytic leukemia protein 1;T-cell leukemia/lymphoma protein 5;tal-1;tal-1 product;TCL5
Extra Details:: Enables several functions, including DNA-binding transcription factor activity; E-box binding activity; and histone deacetylase binding activity. Involved in several processes, including myeloid cell differentiation; positive regulation of cellular component organization; and positive regulation of erythrocyte differentiation. Located in chromatin and nucleoplasm. Part of transcription regulator complex. Implicated in acute lymphoblastic leukemia.