CLDN4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12912
Additional Names:: CLDN4|CPE-R|CPER|CPETR|CPETR1|hCPE-R|WBSCR8
Application:: ELISA, WB, IHC-P
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Uniprot:: O14493
Synonyms:: claudin-4;Clostridium perfringens enterotoxin receptor;Clostridium perfringens enterotoxin receptor 1;CPE-R;CPE-receptor;CPER;CPETR;CPETR1;hCPE-R;WBSCR8;Williams-Beuren syndrome chromosomal region 8 protein
Extra Details:: The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.