Secretagogin (SCGN) Rabbit polyclonal antibody

Size

£152.00

SKU:: A12897
Additional Names:: CALBL|DJ501N12.8|SECRET|Secretagogin (SCGN)|SEGN|setagin
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 27kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Uniprot:: O76038
Synonyms:: CALBL;DJ501N12.8;SECRET;secretagogin;SEGN;setagin
Extra Details:: The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.