ADPRM Rabbit polyclonal antibody

Size

£152.00

SKU:: A12883
Additional Names:: ADPRM|C17orf48|MDS006|NBLA03831
Application:: ELISA, WB
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC
Uniprot:: Q3LIE5
Synonyms:: ADP-ribose/CDP-alcohol pyrophosphatase;ADPRibase-Mn;C17orf48;CDP-choline phosphohydrolase;manganese-dependent ADP-ribose/CDP-alcohol diphosphatase;MDS006;NBLA03831
Extra Details:: Predicted to enable 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity; manganese ion binding activity; and pyrophosphatase activity. Predicted to be located in cytosol.