A12882
TDRD1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12882
- Additional Names:
- CT41.1|TDRD1
- Application:
- ELISA, WB
- Molecular Weight:
- 132kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PFNFEKNENKLPPHESLRSPGTLPNHPNFRLKSSENGNKKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVGSKGDRKKLPAGNSVSPPSAESNSPPKE
- Uniprot:
- Q9BXT4
- Synonyms:
- cancer/testis antigen 41.1;CT41.1;testicular tissue protein Li 193;tudor domain-containing protein 1
- Extra Details:
- This gene encodes a protein containing a tudor domain that is thought to function in the suppression of transposable elements during spermatogenesis. The related protein in mouse forms a complex with piRNAs and Piwi proteins to promote methylation and silencing of target sequences. This gene was observed to be upregulated by ETS transcription factor ERG in prostate tumors.
- Shipping Conditions:
- Blue Ice

