A1288
LIF Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1288
- Additional Names:
- CDF|DIA|HILDA|LIF|MLPLI
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
- Uniprot:
- P15018
- Synonyms:
- CDF;cholinergic differentiation factor;D factor;DIA;differentiation inhibitory activity;differentiation-inducing factor;differentiation-stimulating factor;hepatocyte-stimulating factor III;HILDA;human interleukin in DA cells;leukemia inhibitory factor;melanoma-derived LPL inhibitor;MLPLI
- Extra Details:
- The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice



