LIF Rabbit polyclonal antibody

Size

£152.00

SKU:: A1288
Additional Names:: CDF|DIA|HILDA|LIF|MLPLI
Application:: ELISA, WB, IHC-P
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Uniprot:: P15018
Synonyms:: CDF;cholinergic differentiation factor;D factor;DIA;differentiation inhibitory activity;differentiation-inducing factor;differentiation-stimulating factor;hepatocyte-stimulating factor III;HILDA;human interleukin in DA cells;leukemia inhibitory factor;melanoma-derived LPL inhibitor;MLPLI
Extra Details:: The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.