A12861
TLX1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12861
- Additional Names:
- HOX11|TCL3|TLX1
- Application:
- ELISA, WB
- Molecular Weight:
- 40kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTG
- Uniprot:
- P31314
- Synonyms:
- homeo box-11 (T-cell leukemia-3 associated breakpoint, homologous to Drosophila Notch);homeobox protein Hox-11;HOX11;proto-oncogene TCL-3;T-cell leukemia homeobox protein 1;T-cell leukemia/lymphoma protein 3;TCL3
- Extra Details:
- This gene encodes a nuclear transcription factor that belongs to the NK-linked or NK-like (NKL) subfamily of homeobox genes. The encoded protein is required for normal development of the spleen during embryogenesis. This protein is also involved in specification of neuronal cell fates. Ectopic expression of this gene due to chromosomal translocations is associated with certain T-cell acute lymphoblastic leukemias. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

