TLX1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12861
Additional Names:: HOX11|TCL3|TLX1
Application:: ELISA, WB
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTG
Uniprot:: P31314
Synonyms:: homeo box-11 (T-cell leukemia-3 associated breakpoint, homologous to Drosophila Notch);homeobox protein Hox-11;HOX11;proto-oncogene TCL-3;T-cell leukemia homeobox protein 1;T-cell leukemia/lymphoma protein 3;TCL3
Extra Details:: This gene encodes a nuclear transcription factor that belongs to the NK-linked or NK-like (NKL) subfamily of homeobox genes. The encoded protein is required for normal development of the spleen during embryogenesis. This protein is also involved in specification of neuronal cell fates. Ectopic expression of this gene due to chromosomal translocations is associated with certain T-cell acute lymphoblastic leukemias. Alternate splicing results in multiple transcript variants.