SULT1A2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12851
Additional Names:: HAST4|P-PST|P-PST 2|ST1A2|STP2|SULT1A2|TSPST2
Application:: ELISA, WB
Molecular Weight:: 34kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Uniprot:: P50226
Synonyms:: aryl sulfotransferase 2;arylamine sulfotransferase;HAST4;P-PST;P-PST 2;phenol sulfotransferase 2;phenol-preferring phenol sulfotransferase2;phenol-sulfating phenol sulfotransferase 2;phenolic-metabolizing (P) form of PST;ST1A2;STP2;sulfotransferase 1A2;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2;thermostable phenol sulfotransferase;TSPST2
Extra Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described.