SPOCK3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12849
Additional Names:: HSAJ1454|SPOCK3|TES-3|TICN3
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVMGSRINGVADCAID
Uniprot:: Q9BQ16
Synonyms:: HSAJ1454;SPARC/osteonectin, cwcv and kazal like domains proteoglycan 3;sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3;SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3;TES-3;testican-3;TICN3
Extra Details:: This gene encodes a member of a novel family of calcium-binding proteoglycan proteins that contain thyroglobulin type-1 and Kazal-like domains. The encoded protein and may play a role in adult T-cell leukemia by inhibiting the activity of membrane-type matrix metalloproteinases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.