SLC27A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12847
Additional Names:: ACSVL5|FATP|FATP-1|FATP1|SLC27A1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 71kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
Uniprot:: Q6PCB7
Synonyms:: ACSVL5;FATP;FATP-1;FATP1;fatty acid transport protein 1;long-chain fatty acid transport protein 1;solute carrier family 27 (fatty acid transporter), member 1;Solute carrier family 27 member 1
Extra Details:: Enables biotin transmembrane transporter activity; efflux transmembrane transporter activity; and long-chain fatty acid transporter activity. Involved in several processes, including carboxylic acid transmembrane transport; glycerophospholipid biosynthetic process; and lipid transport across blood-brain barrier. Located in membrane. Part of plasma membrane.