A12844
PPM1J Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12844
- Additional Names:
- PP2C-zeta|PP2CZ|PP2Czeta|PPM1J|PPP2CZ
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAVENAFQLMDEQMARERRGHQVEGGC
- Uniprot:
- Q5JR12
- Synonyms:
- PP2C-zeta;PP2CZ;PP2Czeta;PPP2CZ;protein phosphatase 1J;protein phosphatase 1J (PP2C domain containing);Protein phosphatase 2C isoform zeta;protein phosphatase 2C zeta
- Extra Details:
- This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.
- Shipping Conditions:
- Blue Ice