A12842
POLE2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12842
- Additional Names:
- DPE2|POLE2
- Application:
- ELISA, WB
- Molecular Weight:
- 59kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQRTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLGMITQLKEGKFFLEDPTGTVQLDLSKAQFHSGLYTEACFVLAEGWFEDQVFHVNAFGFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFL
- Uniprot:
- P56282
- Synonyms:
- DNA polymerase epsilon subunit 2;DNA polymerase epsilon subunit B;DNA polymerase II subunit 2;DPE2;polymerase (DNA directed), epsilon 2 (p59 subunit);polymerase (DNA directed), epsilon 2, accessory subunit;polymerase (DNA) epsilon 2, accessory subunit
- Extra Details:
- DNA polymerase epsilon, which is involved in DNA repair and replication, is composed of a large catalytic subunit and a small accessory subunit. The protein encoded by this gene represents the small subunit (B). Defects in this gene have been linked to colorectal cancer and to combined immunodeficiency.
- Shipping Conditions:
- Blue Ice