GBA2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12834
Additional Names:: AD035|GBA2|NLGase|SPG46
Application:: ELISA, WB
Molecular Weight:: 105kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AQDIQDKFSSILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCAGQWFLKACGLGEGDTEVFPTQHVVRALQTIFELNVQAFAGGAMGAVNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASWPKVKQGTGLRTGPMFGPKEAMANLSPE
Uniprot:: Q9HCG7
Synonyms:: AD035;beta-glucocerebrosidase 2;bile acid beta-glucosidase GBA2;bile acid glucosyl transferase GBA2;cholesterol glucosyltransferase GBA2;cholesteryl-beta-glucosidase GBA2;glucocerebrosidase 2;glucosidase, beta (bile acid) 2;glucosylceramidase 2;NLGase;non-lysosomal glucosylceramidase;SPG46
Extra Details:: This gene encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides as endogenous compounds. Studies to determine subcellular localization of this protein in the liver indicated that the enzyme was mainly enriched in the microsomal fraction where it appeared to be confined to the endoplasmic reticulum. This putative transmembrane protein is thought to play a role in carbohydrate transport and metabolism.