SLC19A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12819
Additional Names:: CHMD|FOLT|hRFC|hSLC19A1|IFC-1|IFC1|MEGAF|REFC|RFC|RFC1|RFT-1|SLC19A1
Application:: ELISA, WB
Molecular Weight:: 65kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
Uniprot:: P41440
Synonyms:: CHMD;folate transporter 1;FOLT;hRFC;hSLC19A1;IFC-1;IFC1;intestinal folate carrier 1;MEGAF;placental folate transporter;reduced folate carrier 1;reduced folate carrier protein;reduced folate transporter;reduced folate transporter 1;REFC;RFC;RFC1;RFT-1;solute carrier family 19 (folate transporter), member 1;Solute carrier family 19 member 1
Extra Details:: The membrane protein encoded by this gene is a transporter of folate and is involved in the regulation of intracellular concentrations of folate. Three transcript variants encoding different isoforms have been found for this gene.