A12819
SLC19A1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12819
- Additional Names:
- CHMD|FOLT|hRFC|hSLC19A1|IFC-1|IFC1|MEGAF|REFC|RFC|RFC1|RFT-1|SLC19A1
- Application:
- ELISA, WB
- Molecular Weight:
- 65kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
- Uniprot:
- P41440
- Synonyms:
- CHMD;folate transporter 1;FOLT;hRFC;hSLC19A1;IFC-1;IFC1;intestinal folate carrier 1;MEGAF;placental folate transporter;reduced folate carrier 1;reduced folate carrier protein;reduced folate transporter;reduced folate transporter 1;REFC;RFC;RFC1;RFT-1;solute carrier family 19 (folate transporter), member 1;Solute carrier family 19 member 1
- Extra Details:
- The membrane protein encoded by this gene is a transporter of folate and is involved in the regulation of intracellular concentrations of folate. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

