A12814
Olig2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12814
- Additional Names:
- BHLHB1|bHLHe19|Olig2|OLIGO2|PRKCBP2|RACK17
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSS
- Uniprot:
- Q13516
- Synonyms:
- basic domain, helix-loop-helix protein, class B, 1;BHLHB1;bHLHe19;class B basic helix-loop-helix protein 1;class E basic helix-loop-helix protein 19;human protein kinase C-binding protein RACK17;OLIGO2;oligodendrocyte lineage transcription factor 2;oligodendrocyte transcription factor 2;oligodendrocyte-specific bHLH transcription factor 2;PRKCBP2;protein kinase C-binding protein 2;Protein kinase C-binding protein RACK17;RACK17
- Extra Details:
- This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome.
- Shipping Conditions:
- Blue Ice





