A12807
ITIH4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12807
- Additional Names:
- GP120|H4P|IHRP|ITI-HC4|ITIH4|ITIHL1|PK-120|PK120
- Application:
- ELISA, WB
- Molecular Weight:
- 103kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
- Uniprot:
- Q14624
- Synonyms:
- GP120;H4P;IHRP;inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein);inter-alpha-inhibitor heavy chain 4;inter-alpha-trypsin inhibitor family heavy chain-related protein;inter-alpha-trypsin inhibitor heavy chain family member 4;inter-alpha-trypsin inhibitor heavy chain H4;inter-alpha-trypsin inhibitor, heavy chain-like, 1;ITI heavy chain H4;ITI-HC4;ITIHL1;PK-120;PK120;Plasma kallikrein sensitive glycoprotein 120;plasma kallikrein-sensitive glycoprotein 120
- Extra Details:
- The protein encoded by this gene is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. Expression of this gene has been detected only in liver, and it seems to be upregulated during surgical trauma. This gene is part of a cluster of similar genes on chromosome 3. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

