A12797
ACTN3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12797
- Additional Names:
- ACTN3|ACTN3D
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 103kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ
- Uniprot:
- Q08043
- Synonyms:
- ACTN3D;alpha-actinin skeletal muscle;Alpha-actinin skeletal muscle isoform 3;alpha-actinin-3;F-actin cross-linking protein
- Extra Details:
- This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
- Shipping Conditions:
- Blue Ice