A12796
ACOX2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12796
- Additional Names:
- ACOX2|BCOX|BRCACOX|BRCOX|CBAS6|THCCox
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 76kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQNERYKAAMRRAFHIRLIARRLGWLEDGRELGYAYRALSGDVALNIHRVFVRALRSLGSEEQIAKWDPLCKNIQIIAT
- Uniprot:
- Q99424
- Synonyms:
- 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase;3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase;acyl-CoA oxidase 2, branched chain;acyl-Coenzyme A oxidase 2, branched chain;BCOX;branched chain acyl-CoA oxidase;BRCACOX;BRCOX;CBAS6;peroxisomal acyl-coenzyme A oxidase 2;peroxisomal branched chain acyl-CoA oxidase;THCA-CoA oxidase;THCCox;trihydroxycoprostanoyl-CoA oxidase
- Extra Details:
- The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe cognitive disability, and death in children.
- Shipping Conditions:
- Blue Ice