ITPR3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12794
Additional Names:: CMT1J|IP3R|IP3R3|ITPR3
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 304kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYGDRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIM
Uniprot:: Q14573
Synonyms:: inositol 1,4,5-triphosphate receptor, type 3;inositol 1,4,5-trisphosphate receptor type 3;insP3R3;IP3 receptor;IP3 receptor isoform 3;IP3R;IP3R3;Type 3 inositol 1,4,5-trisphosphate receptor;type 3 InsP3 receptor
Extra Details:: This gene encodes a receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. The receptor contains a calcium channel at the C-terminus and the ligand-binding site at the N-terminus. Knockout studies in mice suggest that type 2 and type 3 inositol 1,4,5-trisphosphate receptors play a key role in exocrine secretion underlying energy metabolism and growth.