NR1H4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12788
Additional Names:: BAR|FXR|HRR-1|HRR1|NR1H4|PFIC5|RIP14
Application:: ELISA, WB
Molecular Weight:: 56kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFAC
Uniprot:: Q96RI1
Synonyms:: BAR;bile acid receptor;farnesoid X nuclear receptor;farnesoid X-activated receptor;farnesol receptor HRR-1;FXR;HRR-1;HRR1;Nuclear receptor subfamily 1 group H member 4;PFIC5;retinoid X receptor-interacting protein 14;RIP14;RXR-interacting protein 14
Extra Details:: This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport. Alternatively spliced transcript variants encoding different isoforms have been described.