A12782
EBF1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12782
- Additional Names:
- COE1|EBF|EBF1|O/E-1|OLF1
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDaa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
- Uniprot:
- Q9UH73
- Synonyms:
- COE1;Collier, Olf and EBF transcription factor 1;early B cell factor 1;Early B-cell factor;EBF;O/E-1;OLF1;olfactory neuronal transcription factor 1;transcription factor COE1
- Extra Details:
- Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of transcription, DNA-templated. Predicted to be located in nucleus. Predicted to be part of chromatin.
- Shipping Conditions:
- Blue Ice