ONECUT1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12774
Additional Names:: HNF-6|HNF6|HNF6A|ONECUT1
Application:: ELISA, WB
Molecular Weight:: 51kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEI
Uniprot:: Q9UBC0
Synonyms:: hepatocyte nuclear factor 6;hepatocyte nuclear factor 6, alpha;HNF-6;HNF6;HNF6A;one cut domain family member 1;One cut homeobox 1
Extra Details:: This gene encodes a member of the Cut homeobox family of transcription factors. Expression of the encoded protein is enriched in the liver, where it stimulates transcription of liver-expressed genes, and antagonizes glucocorticoid-stimulated gene transcription. This gene may influence a variety of cellular processes including glucose metabolism, cell cycle regulation, and it may also be associated with cancer. Alternative splicing results in multiple transcript variants.