Kdm6b Rabbit polyclonal antibody

Size

£152.00

SKU:: A12767
Additional Names:: 1700064E03Rik|Jmjd3|Kdm6b
Application:: ELISA, WB
Molecular Weight:: 177kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
Synonyms:: [histone H3]-trimethyl-L-lysine(27) demethylase 6B;1700064E03Rik;BC038313;jmjC domain-containing protein 3;JMJD3;jumonji domain containing 3;jumonji domain containing 3, histone lysine demethylase;jumonji domain-containing protein 3;lysine (K)-specific demethylase 6B;lysine-specific demethylase 6B;NEDCFSA
Extra Details:: Enables beta-catenin binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and sequence-specific DNA binding activity. Involved in several processes, including histone H3-K27 demethylation; mesodermal cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including cellular response to hydrogen peroxide; histone demethylation; and positive regulation of transcription by RNA polymerase II. Located in nucleus. Is expressed in several structures, including brain; gut; liver; metanephros; and olfactory epithelium. Orthologous to human KDM6B (lysine demethylase 6B).

Shipping Conditions:: Blue Ice