NAT2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12766
Additional Names:: AAC2|NAT-2|NAT2|PNAT
Application:: ELISA, WB, IHC-P
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI
Uniprot:: P11245
Synonyms:: AAC2;arylamide acetylase 2;arylamine N-acetyltransferase 2;N-acetyltransferase 2 (arylamine N-acetyltransferase);N-acetyltransferase type 2;NAT-2;PNAT;Polymorphic arylamine N-acetyltransferase
Extra Details:: This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second polymorphic arylamine N-acetyltransferase gene (NAT1), is located near this gene (NAT2).