A1273
UQCRB Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1273
- Additional Names:
- MC3DN3|QCR7|QP-C|QPC|UQBC|UQBP|UQCR6|UQCRB|UQPC
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
- Uniprot:
- P14927
- Synonyms:
- complex III subunit 7;complex III subunit VII;cytochrome b-c1 complex subunit 7;MC3DN3;mitochondrial ubiquinone-binding protein;QCR7;QP-C;QPC;ubiquinol-cytochrome c reductase complex 14 kDa protein;ubiquinol-cytochrome c reductase, complex III subunit VI;UQBC;UQBP;UQCR6;UQPC
- Extra Details:
- This gene encodes a subunit of the ubiquinol-cytochrome c oxidoreductase complex, which consists of one mitochondrial-encoded and 10 nuclear-encoded subunits. The protein encoded by this gene binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. This protein plays an important role in hypoxia-induced angiogenesis through mitochondrial reactive oxygen species-mediated signaling. Mutations in this gene are associated with mitochondrial complex III deficiency. Alternatively spliced transcript variants have been found for this gene. Related pseudogenes have been identified on chromosomes 1, 5 and X.
- Shipping Conditions:
- Blue Ice