A12722
Tafazzin / TAZ Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12722
- Additional Names:
- BTHS|CMD3A|EFE|EFE2|G4.5|LVNCX|Tafazzin / TAZ|TAZ|Taz1
- Application:
- ELISA, WB
- Molecular Weight:
- 25-35kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
- Uniprot:
- Q16635
- Synonyms:
- BTHS;CMD3A;EFE;EFE2;G4.5;LVNCX;protein G4.5;tafazzin;TAZ;Taz1
- Extra Details:
- This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
- Shipping Conditions:
- Blue Ice