ACKR3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12712
Additional Names:: ACKR3|CMKOR1|CXC-R7|CXCR-7|CXCR7|GPR159|RDC-1|RDC1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 44kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSS
Uniprot:: P25106
Synonyms:: atypical chemokine receptor 3;C-X-C chemokine receptor type 7;chemokine (C-X-C motif) receptor 7;chemokine orphan receptor 1;CMKOR1;CXC-R7;CXCR-7;CXCR7;G protein-coupled receptor;G-protein coupled receptor 159;G-protein coupled receptor RDC1 homolog;GPR159;RDC-1;RDC1
Extra Details:: This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.