A12704
[KO Validated] KRAS Rabbit polyclonal antibody

Size
POA
- SKU:
- A12704
- Additional Names:
- 'C-K-RAS|AS|C-K-RAS|c-Ki-ras|c-Ki-ras2|CFC2|K-Ras|K-Ras 2|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS1|KRAS2|NS|NS3|OES|RALD|RASK2
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 21kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCII
- Uniprot:
- P01116
- Synonyms:
- 'C-K-RAS;C-K-RAS;c-Ki-ras;c-Ki-ras2;c-Kirsten-ras protein;cellular c-Ki-ras2 proto-oncogene;cellular transforming proto-oncogene;CFC2;GTPase KRas;K-Ras;K-Ras 2;K-ras p21 protein;K-RAS2A;K-RAS2B;K-RAS4A;K-RAS4B;KI-RAS;Kirsten rat sarcoma viral oncogene homolog;Kirsten rat sarcoma viral proto-oncogene;KRAS1;KRAS2;NS;NS3;OES;oncogene KRAS2;PR310 c-K-ras oncogene;RALD;RASK2;transforming protein p21;v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
- Extra Details:
- This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.
- Shipping Conditions:
- Blue Ice
![[KO Validated] KRAS Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12704/A12704_1.jpg)
![[KO Validated] KRAS Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12704/A12704_2.jpg)
![[KO Validated] KRAS Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12704/A12704_3.jpg)
![[KO Validated] KRAS Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12704/A12704_N180-4_KO-WB_01.jpg)
![[KO Validated] KRAS Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12704/A12704_N180-4_WB_01.jpg)
![[KO Validated] KRAS Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12704/A12704_N179_IF_01.jpg)