A12703
CD248 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12703
- Additional Names:
- CD164L1|CD248|TEM1
- Application:
- ELISA, WB
- Molecular Weight:
- 81kDa/165kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLA
- Uniprot:
- Q9HCU0
- Synonyms:
- 2610111G01Rik;CD164 sialomucin-like 1;CD164L1;CD248 antigen, endosialin;CD248 molecule, endosialin;endosialin;TEM1;tumor endothelial marker 1
- Extra Details:
- Predicted to enable extracellular matrix binding activity and extracellular matrix protein binding activity. Predicted to be involved in cell migration. Predicted to act upstream of or within several processes, including anatomical structure regression; lymph node development; and positive regulation of endothelial cell apoptotic process. Located in extracellular exosome.
- Shipping Conditions:
- Blue Ice