A12697
PSME3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12697
- Additional Names:
- HEL-S-283|Ki|PA28-gamma|PA28G|PA28gamma|PSME3|REG-GAMMA
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 35kDa/30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
- Uniprot:
- P61289
- Synonyms:
- 11S regulator complex gamma subunit;11S regulator complex subunit gamma;activator of multicatalytic protease subunit 3;epididymis secretory protein Li 283;HEL-S-283;Ki;Ki antigen;Ki nuclear autoantigen;PA28 gamma variant 5;PA28-gamma;PA28G;PA28gamma;proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki);proteasome activator 28 subunit gamma;proteasome activator 28-gamma;proteasome activator complex subunit 3;REG gamma-3;REG-GAMMA
- Extra Details:
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice