A12621
Occludin Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12621
- Additional Names:
- BLCPMG|Occludin|PPP1R115|PTORCH1
- Application:
- ELISA, WB
- Molecular Weight:
- 62kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL
- Uniprot:
- Q16625
- Synonyms:
- BLCPMG;occludin;phosphatase 1, regulatory subunit 115;PPP1R115;PTORCH1
- Extra Details:
- This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5.
- Shipping Conditions:
- Blue Ice

_WB_01.jpg)