A12601
DNAL1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12601
- Additional Names:
- C14orf168|CILD16|DNAL1|LC1
- Application:
- ELISA, WB
- Molecular Weight:
- 22kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
- Uniprot:
- Q4LDG9
- Synonyms:
- C14orf168;CILD16;dynein axonemal light chain 1;dynein light chain 1, axonemal;LC1
- Extra Details:
- This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice