A12596
ASAH2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12596
- Additional Names:
- ASAH2|BCDase|HNAC1|LCDase|N-CDase|NCDase
- Application:
- ELISA, WB
- Molecular Weight:
- 85kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TATQTSPVPLTPESPLFQNFSGYHIGVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQGP
- Uniprot:
- Q9NR71
- Synonyms:
- acylsphingosine deacylase 2;BCDase;HNAC1;LCDase;mitochondrial ceramidase;N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2;N-acylsphingosine amidohydrolase 2;N-CDase;NCDase;neutral ceramidase;neutral/alkaline ceramidase;non-lysosomal ceramidase
- Extra Details:
- Ceramidases (EC 3.5.1.23), such as ASAH2, catalyze hydrolysis of the N-acyl linkage of ceramide, a second messenger in a variety of cellular events, to produce sphingosine. Sphingosine exerts both mitogenic and apoptosis-inducing activities, and its phosphorylated form functions as an intra- and intercellular second messenger (see MIM 603730) (Mitsutake et al., 2001 [PubMed 11328816]).
- Shipping Conditions:
- Blue Ice