SIRT2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12575
Additional Names:: SIR2|SIR2L|SIR2L2|SIRT2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHA
Uniprot:: Q8IXJ6
Synonyms:: NAD-dependent deacetylase sirtuin-2;NAD-dependent protein deacetylase sirtuin-2;regulatory protein SIR2 homolog 2;silent information regulator 2;SIR2;SIR2-like protein 2;sir2-related protein type 2;SIR2L;SIR2L2;sirtuin type 2
Extra Details:: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.