A12572
TRPM8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12572
- Additional Names:
- LTrpC-6|LTRPC6|trp-p8|TRPM8|TRPP8
- Application:
- ELISA, WB
- Molecular Weight:
- 122kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
- Uniprot:
- Q7Z2W7
- Synonyms:
- Long transient receptor potential channel 6;LTrpC-6;LTRPC6;transient receptor potential cation channel subfamily M member 8;transient receptor potential p8;transient receptor potential subfamily M member 8;trp-p8;TRPM8 cationic channel;TRPP8
- Extra Details:
- Predicted to enable ligand-gated calcium channel activity. Predicted to be involved in calcium ion transmembrane transport and positive regulation of cold-induced thermogenesis. Predicted to act upstream of or within several processes, including cellular calcium ion homeostasis; response to cold; and thermoception. Located in plasma membrane.
- Shipping Conditions:
- Blue Ice

