TIA1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12523
Additional Names:: ALS26|TIA-1|TIA1|WDM
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 44kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Uniprot:: P31483
Synonyms:: ALS26;nucleolysin TIA-1;nucleolysin TIA-1 isoform p40;p40-TIA-1;p40-TIA-1 (containing p15-TIA-1);RNA-binding protein TIA-1;T-cell-restricted intracellular antigen-1;TIA-1;WDM
Extra Details:: The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene.