MT-ND5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12465
Additional Names:: MT-ND5|ND5
Application:: ELISA, WB
Molecular Weight:: 67kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KIIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLFMCSGSIIHSLADEQDIRKMGNITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAIN
Uniprot:: P03915
Synonyms:: MTND5;NADH dehydrogenase subunit 5
Extra Details:: Contributes to NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Is expressed in central nervous system; heart; liver; metanephros; and retina. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and MELAS syndrome. Orthologous to human MT-ND5 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5).