IGFBP5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12451
Additional Names:: IBP5|IGFBP5
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 33kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVG
Uniprot:: P24593
Synonyms:: IBP-5;IBP5;IGF-binding protein 5;IGFBP-5;insulin-like growth factor-binding protein 5
Extra Details:: Enables insulin-like growth factor I binding activity. Involved in several processes, including cellular response to cAMP; regulation of smooth muscle cell migration; and regulation of smooth muscle cell proliferation. Part of insulin-like growth factor ternary complex. Biomarker of pulmonary fibrosis.