A12444
HLA-DRB3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12444
- Additional Names:
- DRB3|HLA-DPB1|HLA-DR1B|HLA-DR3B|HLA-DRB3|HLA-DRB3*
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSK
- Uniprot:
- P79483
- Synonyms:
- DRB3;HLA class II histocompatibility antigen, DR beta 3 chain;HLA DRB3;HLA-DPB1;HLA-DR1B;HLA-DR3B;HLA-DRB3*;human leucocyte antigen DRB3;major histocompatibility complex, class II, DR beta 3;MHC class II antigen DR beta 3 chain;MHC class II antigen DRB3;MHC class II DR beta chain;MHC class II HLA-DR beta 3 chain;MHC class II protein
- Extra Details:
- HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. There are multiple pseudogenes of this gene.
- Shipping Conditions:
- Blue Ice

