Clathrin heavy chain Rabbit polyclonal antibody

Size

£152.00

SKU:: A12423
Additional Names:: CHC|CHC17|Clathrin heavy chain|CLH-17|CLTCL2|Hc|MRD56
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 191kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
Uniprot:: Q00610
Synonyms:: CHC;CHC17;clathrin heavy chain 1;clathrin heavy chain on chromosome 17;clathrin, heavy polypeptide (Hc);clathrin, heavy polypeptide-like 2;CLH-17;CLTCL2;Hc;MRD56
Extra Details:: Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.