PRSS1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1242
Additional Names:: PRSS1|TRP1|TRY1|TRY4|TRYP1
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 27 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Uniprot:: P07477
Synonyms:: beta-trypsin;cationic trypsinogen;digestive zymogen;nonfunctional trypsin 1;protease, serine 1;Serine protease 1;TCR V beta 4.1;TRP1;TRY1;TRY4;TRYP1;Trypsin I;trypsin-1;trypsinogen 1;trypsinogen A
Extra Details:: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.