A12411
AGR2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A12411
- Additional Names:
- AG-2|AG2|AGR2|GOB-4|HAG-2|HEL-S-116|HPC8|PDIA17|RIFTD|XAG-2
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKL
- Uniprot:
- O95994
- Synonyms:
- AG-2;AG2;anterior gradient homolog 2;anterior gradient protein 2 homolog;epididymis secretory protein Li 116;GOB-4;HAG-2;HEL-S-116;HPC8;PDIA17;protein disulfide isomerase family A, member 17;secreted cement gland homolog;secreted cement gland protein XAG-2 homolog;XAG-2
- Extra Details:
- This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression.
- Shipping Conditions:
- Blue Ice





