A12387
SIGLEC6 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12387
- Additional Names:
- CD327|CD33L|CD33L1|CD33L2|CDW327|OBBP1|SIGLEC6
- Application:
- ELISA, WB
- Molecular Weight:
- 72kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFP
- Uniprot:
- O43699
- Synonyms:
- CD327;CD33 antigen-like 1;CD33L;CD33L1;CD33L2;CDW327;OBBP1;obesity-binding protein 1;sialic acid-binding Ig-like lectin 6
- Extra Details:
- This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia.
- Shipping Conditions:
- Blue Ice

