SIGLEC6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12387
Additional Names:: CD327|CD33L|CD33L1|CD33L2|CDW327|OBBP1|SIGLEC6
Application:: ELISA, WB
Molecular Weight:: 72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFP
Uniprot:: O43699
Synonyms:: CD327;CD33 antigen-like 1;CD33L;CD33L1;CD33L2;CDW327;OBBP1;obesity-binding protein 1;sialic acid-binding Ig-like lectin 6
Extra Details:: This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia.